Recombinant Human Bone morphogenetic protein 4 (BMP4)
Shipping Cost Note
Each Recombinant Protein price includes shipping cost to Canada and import fees. Please ask for a discounted quote if ordering multiple Cusabio products.
Delivery Time Note
This product is usually imported from the manufacturer after order placement. Please expect longer delivery times of 7-14 days.
Catalog No.
CSB-EP002740HU
Product Name
Recombinant Human Bone morphogenetic protein 4 (BMP4)
In Stock
Yes
Activity
Not Tested
Research Area
Developmental Biology
Uniprot ID
P12644
Gene Names
BMP4
Alternative Names
Bone morphogenetic protein 2B ;BMP-2B
Organism
Homo sapiens (Human)
Source
E.coli
Expressed Region
293-408aa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Target Protein Sequence
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
MW
29.1 kDa
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Not Tested.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Resonstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevances
Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during bryonic mammary development and to inhibit hair follicle induction .
References
Mutations in BMP4 are associated with subepithelial, microform, and overt cleft lip.Suzuki S., Marazita M.L., Cooper M.E., Miwa N., Hing A., Jugessur A., Natsume N., Shimozato K., Ohbayashi N., Suzuki Y., Niimi T., Minami K., Yamamoto M., Altannamar T.J., Erkhembaatar T., Furukawa H., Daack-Hirsch S., L'heureux J. , Brandon C.A., Weinberg S.M., Neiswanger K., Deleyiannis F.W., de Salamanca J.E., Vieira A.R., Lidral A.C., Martin J.F., Murray J.C.Am. J. Hum. Genet. 84:406-411(2009)
Function
Induces cartilage and bone formation. Also act in mesoderm induction, tooth development, limb formation and fracture repair. Acts in concert with PTHLH/PTHRP to stimulate ductal outgrowth during embryonic mammary development and to inhibit hair follicle induction (By similarity).
Additional Product Information
Product MSDS

