top of page
Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial

Shipping Cost Note

Each Recombinant Protein price includes shipping cost to Canada and import fees. Please ask for a discounted quote if ordering multiple Cusabio products.

 

Delivery Time Note

This product is usually imported from the manufacturer after order placement. Please expect longer delivery times of 7-14 days.

 

Catalog No.

CSB-YP718162EEZ(A4)

 

Product Name

Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial

 

In Stock

Yes

 

Activity

Not Tested

 

Research Area

Others

 

Uniprot ID

Q69022

 

Gene Names

EBNA2

 

Alternative Names

EBNA2; BYRF1Epstein-Barr nuclear antigen 2; EBNA-2; EBV nuclear antigen 2

 

Organism

Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4)

 

Source

Yeast

 

Expressed Region

247-454aa

 

Protein Length

Partial

 

Tag Info

N-terminal 6xHis-tagged and C-terminal Myc-tagged

 

Target Protein Sequence

SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ

 

MW

25.9 kDa

 

Purity

Greater than 90% as determined by SDS-PAGE.

 

Endotoxin

Not Tested.

 

Form

Liquid or Lyophilized powder

 

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

 

Resonstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

 

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

 

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

 

Relevances

Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells (By similarity).

 

References

"U2 region of Epstein-Barr virus DNA may encode Epstein-Barr nuclear antigen 2."Dambaugh T., Hennessy K., Chamnankit L., Kieff E.Proc. Natl. Acad. Sci. U.S.A. 81:7632-7636(1984)

 

Function

Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells (By similarity).

C$640.00Price

Related Products

LUNA NANOTECH

13 - 85 Citizen Court
Markham, Ontario, Canada
L6G 1A8
info@lunanano.ca


Tel: 800-474-4055

To request a quote, or to order via email:
sales@lunanano.ca

PRODUCTS

OUR COMPANY

  • Facebook Social Icon
  • Twitter Social Icon
bottom of page