Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial

Shipping Cost Note
Each Recombinant Protein price includes shipping cost to Canada and import fees. Please ask for a discounted quote if ordering multiple Cusabio products.
 
Delivery Time Note
This product is usually imported from the manufacturer after order placement. Please expect longer delivery times of 7-14 days.
 
Catalog No.
CSB-EP005741HU1
 
Product Name
Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial
 
In Stock
Yes
 
Activity
Not Tested
 
Research Area
Cancer
 
Uniprot ID
P02462
 
Gene Names
COL4A1
 
Alternative Names
Arresten; BSVD; CO4A1_HUMAN; COL4A1; COL4A1 NC1 domain; COL4A2; COL4A3; COL4A4; COL4A5; collagen alpha-1(IV) chain; Collagen IV Alpha 1 Polypeptide; Collagen IV Alpha 2 Polypeptide; Collagen Of Basement Membrane Alpha 1 Chain; Collagen Of Basement Membrane Alpha 2 Chain; Collagen Type IV Alpha 1; collagen type IV alpha 1 chain; Collagen Type IV Alpha 2; Collagen Type IV Alpha 3; Collagen Type IV Alpha 4; Collagen Type IV Alpha 5; RATOR
 
Organism
Homo sapiens (Human)
 
Source
E.coli
 
Expressed Region
30-167aa
 
Protein Length
Partial
 
Tag Info
N-terminal GST-tagged
 
Target Protein Sequence
GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP
 
MW
39.9 kDa
 
Purity
Greater than 90% as determined by SDS-PAGE.
 
Endotoxin
Not Tested.
 
Form
Liquid or Lyophilized powder
 
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
 
Resonstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
 
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. 
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
 
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
 
Relevances
Type IV collagen is the major structural component of glomerular basent mbranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation. Inhibits expression of hypoxia-inducible factor 1alpha and ERK1/2 and p38 MAPK activation. Ligand for alpha1/beta1 integrin.
 
References
Structural organization of the gene for the alpha 1 chain of human type IV collagen.Soininen R., Huotari M., Ganguly A., Prockop D.J., Tryggvason K.J. Biol. Chem. 264:13565-13571(1989)
 
Function
Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.