Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial
Shipping Cost Note
Each Recombinant Protein price includes shipping cost to Canada and import fees. Please ask for a discounted quote if ordering multiple Cusabio products.
Delivery Time Note
This product is usually imported from the manufacturer after order placement. Please expect longer delivery times of 7-14 days.
Catalog No.
CSB-YP005725HU
Product Name
Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial
In Stock
Yes
Activity
Not Tested
Research Area
Cell Adhesion
Uniprot ID
P39060
Gene Names
COL18A1
Alternative Names
Alpha 1 collagen type 18 (XVIII)(COL18A1); Alpha 1 type XVIII collagen; Antiangiogenic agent; COIA1_HUMAN; COL15A1; Col18a1; Collagen alpha 1(XV) chain; Collagen alpha 1(XVIII) chain; Collagen alpha-1(XV) chain; Collagen type XV proteoglycan; Collagen type XVIII alpha 1; Collagen XV; alpha 1 polypeptide; Collagen; type XV; alpha 1; Endostatin; Endostatin XV; FLJ27325; FLJ34914; FLJ38566; KNO; KNO1; KS; MGC74745; Multi functional protein MFP; OTTHUMP00000021782; OTTHUMP00000115472; OTTHUMP00000115473
Organism
Homo sapiens (Human)
Source
Yeast
Expressed Region
1578-1754aa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Target Protein Sequence
QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
MW
21.3 kDa
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Not Tested.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Resonstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevances
COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.
References
Complete primary structure of two variant forms of human type XVIII collagen and tissue-specific differences in the expression of the corresponding transcripts.Saarela J., Ylikarppa R., Rehn M., Purmonen S., Pihlajaniemi T.Matrix Biol. 16:319-328(1998)
Function
Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.
Additional Product Information
Product MSDS















