Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2)

Shipping Cost Note
Each Recombinant Protein price includes shipping cost to Canada and import fees. Please ask for a discounted quote if ordering multiple Cusabio products.
 
Delivery Time Note
This product is usually imported from the manufacturer after order placement. Please expect longer delivery times of 7-14 days.
 
Catalog No.
CSB-EP365848HML
 
Product Name
Recombinant Human papillomavirus type 16 Minor capsid protein L2 (L2)
 
In Stock
Yes
 
Activity
Not Tested
 
Research Area
Others
 
Uniprot ID
P03107
 
Gene Names
L2
 
Alternative Names
L2; Minor capsid protein L2
 
Organism
Human papillomavirus type 16
 
Source
E.coli
 
Expressed Region
1-473aa
 
Protein Length
Full Length
 
Tag Info
N-terminal 6xHis-SUMO-tagged
 
Target Protein Sequence
MRHKRSAKRTKRASATQLYKTCKQAGTCPPDIIPKVEGKTIAEQILQYGSMGVFFGGLGIGTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTSVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKVVDPAFVTTPTKLITYDNPAYEGIDVDNTLYFSSNDNSINIAPDPDFLDIVALHRPALTSRRTGIRYSRIGNKQTLRTRSGKSIGAKVHYYYDLSTIDPAEEIELQTITPSTYTTTSHAASPTSINNGLYDIYADDFITDTSTTPVPSVPSTSLSGYIPANTTIPFGGAYNIPLVSGPDIPINITDQAPSLIPIVPGSPQYTIIADAGDFYLHPSYYMLRKRRKRLPYFFSDVSLAA
 
MW
66.7 kDa
 
Purity
Greater than 90% as determined by SDS-PAGE.
 
Endotoxin
Not Tested.
 
Form
Liquid or Lyophilized powder
 
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
 
Resonstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
 
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. 
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
 
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
 
Relevances
Minor protein of the capsid that localizes along the inner surface of the virion, within the central cavities beneath the L1 pentamers. Plays a role in capsid stabilization through interaction with the major capsid protein L1. Once the virion enters the host cell, escorts the genomic DNA into the nucleus, in particular by promoting virion endosomal escape. It is involved, through its interaction with host dynein, in the intracellular microtubule-dependent transport of viral capsid toward the nucleus. Mediates the viral genome import into the nucleus through binding to host importins. Once within the nucleus, L2 localizes viral genomes to PML bodies in order to activate early gene expression for establishment of infection. Later on, promotes late gene expression by interacting with the viral E2 protein and by inhibiting its transcriptional activation functions. During virion assbly, encapsidates the genome by direct interaction with the viral DNA.
 
References
Identification of the dynein light chains required for human papillomavirus infection.Schneider M.A., Spoden G.A., Florin L., Lambert C.Cell. Microbiol. 13:32-46(2011)
 
Function
Minor protein of the capsid that localizes along the inner surface of the virion, within the central cavities beneath the L1 pentamers. Plays a role in capsid stabilization through interaction with the major capsid protein L1. Once the virion enters the host cell, L2 escorts the genomic DNA into the nucleus by promoting escape from the endosomal compartments and traffic through the host Golgi network. Plays a role through its interaction with host dynein in the intracellular microtubule-dependent transport of viral capsid toward the nucleus. Mediates the viral genome import into the nucleus through binding to host importins. Once within the nucleus, L2 localizes viral genomes to host PML bodies in order to activate early gene expression for establishment of infection. Later on, promotes late gene expression by interacting with the viral E2 protein and by inhibiting its transcriptional activation functions. During virion assembly, encapsidates the genome by direct interaction with the viral DNA.