Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (v

Shipping Cost Note

Each Recombinant Protein price includes shipping cost to Canada and import fees. Please ask for a discounted quote if ordering multiple Cusabio products.

Delivery Time Note

This product is usually imported from the manufacturer after order placement. Please expect longer delivery times of 7-14 days.

Catalog No.

CSB-EP519253HXB

Product Name

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)

In Stock

Yes

Activity

Not Tested

Research Area

Others

Uniprot ID

O12160

Gene Names

vpr

Alternative Names

(R ORF protein)(Viral protein R)

Organism

Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) (HIV-1)

Source

E.coli

Expressed Region

1-96aa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence

MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHGLGQHIYETYGDTWTGVEAIIRILQRLLFVHFRIGCQHSRIGILRQRRARNGASRS

18.9 kDa

Purity

Greater than 85% as determined by SDS-PAGE.

Endotoxin

Not Tested.

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Resonstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevances

During virus replication, may deplete host UNG protein, and incude G2-M cell cycle arrest. Acts by targeting specific host proteins for degradation by the 26S proteasome, through association with the cellular CUL4A-DDB1 E3 ligase complex by direct interaction with host VPRPB/DCAF-1. Cell cycle arrest reportedly occurs within hours of infection and is not blocked by antiviral agents, suggesting that it is initiated by the VPR carried into the virion. Additionally, VPR induces apoptosis in a cell cycle dependent manner suggesting that these two effects are mechanistically linked. Detected in the serum and cerebrospinal fluid of AIDS patient, VPR may also induce cell death to bystander cells. ; During virus entry, plays a role in the transport of the viral pre-integration (PIC) complex to the host nucleus. This function is crucial for viral infection of non-dividing macrophages. May act directly at the nuclear pore complex, by binding nucleoporins phenylalanine-glycine (FG)-repeat regions.

References

"Molecular cloning and analysis of functional envelope genes from human immunodeficiency virus type 1 sequence subtypes A through G. The WHO and NIAID Networks for HIV Isolation and Characterization." Gao F., Morrison S.G., Robertson D.L., Thornton C.L., Craig S., Karlsson G., Sodroski J., Morgado M., Galvao-Castro B., von Briesen H., Beddows S., Weber J., Sharp P.M., Shaw G.M., Hahn B.H. J. Virol. 70:1651-1667(1996)

Function