Recombinant Vesicular stomatitis Indiana virus Matrix protein (M)

Shipping Cost Note
Each Recombinant Protein price includes shipping cost to Canada and import fees. Please ask for a discounted quote if ordering multiple Cusabio products.
 
Delivery Time Note
This product is usually imported from the manufacturer after order placement. Please expect longer delivery times of 7-14 days.
 
Catalog No.
CSB-BP356390VBG
 
Product Name
Recombinant Vesicular stomatitis Indiana virus Matrix protein (M)
 
In Stock
Yes
 
Activity
Not Tested
 
Research Area
Signal Transduction
 
Uniprot ID
P04876
 
Gene Names
M
 
Alternative Names
M; Matrix protein
 
Organism
Vesicular stomatitis Indiana virus (strain Glasgow) (VSIV)
 
Source
Baculovirus
 
Expressed Region
1-237aa
 
Protein Length
Full Length
 
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
 
Target Protein Sequence
MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTHDPNQLRYEKSFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEEEASGAWVLDSVRHSKWASLASSF
 
MW
30.7 kDa
 
Purity
Greater than 85% as determined by SDS-PAGE.
 
Endotoxin
Not Tested.
 
Form
Liquid or Lyophilized powder
 
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
 
Resonstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
 
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. 
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
 
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
 
Relevances
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shut off presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell.
 
References
"Sequence alterations in temperature-sensitive M-protein mutants (complementation group III) of vesicular stomatitis virus."
Gopalakrishna Y., Lenard J.
J. Virol. 56:655-659(1985)
 
Function
Plays a major role in assembly and budding of virion. Condensates the ribonucleocapsid core during virus assembly. Shut off cellular transcription by inhibiting mRNA nuclear export through direct interaction with host RAE1-NUP98 complex. This shut off presumably inhibit interferon signaling and thus establishment of antiviral state in virus infected cells. Induces cell-rounding, cytoskeleton disorganization and apoptosis in infected cell (By similarity).